Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:31958] [255631] (4 PDB entries) |
Domain d2vztb3: 2vzt B:336-674 [243983] Other proteins in same PDB: d2vzta1, d2vzta2, d2vzta4, d2vzta5, d2vztb1, d2vztb2, d2vztb4, d2vztb5 automated match to d2vzsa5 complexed with act, cd, pnj |
PDB Entry: 2vzt (more details), 2.2 Å
SCOPe Domain Sequences for d2vztb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vztb3 c.1.8.0 (B:336-674) automated matches {Amycolatopsis orientalis [TaxId: 31958]} dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp ydyvppvywydksqkdrggawsfnsatsagvdiptmdtlkrmmsaseldtmwknpsakqy hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp stgliywmlnspwtslhwqlfdaymdqngayygakkane
Timeline for d2vztb3: