Lineage for d2vztb3 (2vzt B:336-674)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1570674Species Amycolatopsis orientalis [TaxId:31958] [255631] (4 PDB entries)
  8. 1570678Domain d2vztb3: 2vzt B:336-674 [243983]
    Other proteins in same PDB: d2vzta1, d2vzta2, d2vzta4, d2vzta5, d2vztb1, d2vztb2, d2vztb4, d2vztb5
    automated match to d2vzsa5
    complexed with act, cd, pnj

Details for d2vztb3

PDB Entry: 2vzt (more details), 2.2 Å

PDB Description: complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vztb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vztb3 c.1.8.0 (B:336-674) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg
hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl
rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp
ydyvppvywydksqkdrggawsfnsatsagvdiptmdtlkrmmsaseldtmwknpsakqy
hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp
stgliywmlnspwtslhwqlfdaymdqngayygakkane

SCOPe Domain Coordinates for d2vztb3:

Click to download the PDB-style file with coordinates for d2vztb3.
(The format of our PDB-style files is described here.)

Timeline for d2vztb3: