Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries) |
Domain d2vzta1: 2vzt A:49-225 [243976] Other proteins in same PDB: d2vzta2, d2vzta3, d2vzta4, d2vzta5, d2vztb2, d2vztb3, d2vztb4, d2vztb5 automated match to d2vzsa4 complexed with act, cd, pnj |
PDB Entry: 2vzt (more details), 2.2 Å
SCOPe Domain Sequences for d2vzta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzta1 b.18.1.0 (A:49-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]} gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg
Timeline for d2vzta1: