Lineage for d2vzob5 (2vzo B:778-899)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036821Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2036822Protein automated matches [254633] (8 species)
    not a true protein
  7. 2036823Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 2036841Domain d2vzob5: 2vzo B:778-899 [243975]
    Other proteins in same PDB: d2vzoa1, d2vzoa3, d2vzob1, d2vzob3
    automated match to d2vzsa2
    complexed with act, cd, gol

Details for d2vzob5

PDB Entry: 2vzo (more details), 2.24 Å

PDB Description: crystal structure of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzob5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzob5 b.1.4.0 (B:778-899) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
gsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvd
skvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvp
ad

SCOPe Domain Coordinates for d2vzob5:

Click to download the PDB-style file with coordinates for d2vzob5.
(The format of our PDB-style files is described here.)

Timeline for d2vzob5: