Lineage for d2vzob4 (2vzo B:675-777)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768616Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1768617Protein automated matches [254633] (7 species)
    not a true protein
  7. 1768618Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 1768635Domain d2vzob4: 2vzo B:675-777 [243974]
    Other proteins in same PDB: d2vzoa1, d2vzoa3, d2vzob1, d2vzob3
    automated match to d2vzsa3
    complexed with act, cd, gol

Details for d2vzob4

PDB Entry: 2vzo (more details), 2.24 Å

PDB Description: crystal structure of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzob4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzob4 b.1.4.0 (B:675-777) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav
tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg

SCOPe Domain Coordinates for d2vzob4:

Click to download the PDB-style file with coordinates for d2vzob4.
(The format of our PDB-style files is described here.)

Timeline for d2vzob4: