Lineage for d2vpqa2 (2vpq A:115-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 2541901Species Staphylococcus aureus [TaxId:1280] [225146] (3 PDB entries)
  8. 2541904Domain d2vpqa2: 2vpq A:115-329 [243923]
    Other proteins in same PDB: d2vpqa1, d2vpqa3, d2vpqb1, d2vpqb3
    automated match to d1ulza3
    complexed with anp, cl, mg

Details for d2vpqa2

PDB Entry: 2vpq (more details), 2.1 Å

PDB Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2vpqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpqa2 d.142.1.0 (A:115-329) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdvakaemikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardek
eletgfrmteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrm
qklveeapspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriq
vehpvtemvtgidlvklqlqvamgdvlpykqedik

SCOPe Domain Coordinates for d2vpqa2:

Click to download the PDB-style file with coordinates for d2vpqa2.
(The format of our PDB-style files is described here.)

Timeline for d2vpqa2: