Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (3 PDB entries) |
Domain d2vk4c3: 2vk4 C:361-560 [243902] Other proteins in same PDB: d2vk4a2, d2vk4b2, d2vk4c2, d2vk4d2 automated match to d1qpba3 complexed with mg, tpp |
PDB Entry: 2vk4 (more details), 1.95 Å
SCOPe Domain Sequences for d2vk4c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vk4c3 c.36.1.0 (C:361-560) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml ptmdapsnlvkqaqltaatn
Timeline for d2vk4c3: