SCOPe 2.08: Domain d2v70c_: 2v70 C:

Lineage for d2v70c_ (2v70 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d2v70c_: 2v70 C: [243843]
   automated match to d2v9tb_
   complexed with nag

Details for d2v70c_

PDB Entry: 2v70, 3.01 Å

PDB Description: third lrr domain of human slit2

PDB Compounds: (C:) slit homolog 2 protein n-product

SCOPe Domain Sequences for d2v70c_:

Sequence; same for both SEQRES and ATOM records:

>d2v70c_ c.10.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkin
fsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgnd
sfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrkkri
vtgnprcqkpyflkeipiqdvaiqdftcdd

Timeline for d2v70c_:

• d2v70c_ first appeared in SCOPe 2.04
  
• d2v70c_ appears in SCOPe 2.07