SCOPe 2.04: Domain d2rsya_: 2rsy A:

Lineage for d2rsya_ (2rsy A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)

8. Domain d2rsya_: 2rsy A: [243772]
   automated match to d3eaza_

Details for d2rsya_

PDB Entry: 2rsy

PDB Description: solution structure of the sh2 domain of csk in complex with a phosphopeptide from cbp

PDB Compounds: (A:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d2rsya_:

Sequence; same for both SEQRES and ATOM records:

>d2rsya_ d.93.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gplgsmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyh
asklsideevyfenlmqlvehyttdadglctrlikpkvm

Timeline for d2rsya_:

• d2rsya_ is new in SCOPe 2.04-stable
  
• d2rsya_ appears in SCOPe 2.05
  
• d2rsya_ appears in the current release, SCOPe 2.08, called d2rsya1