Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (3 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries) |
Domain d2rsya_: 2rsy A: [243772] automated match to d3eaza_ |
PDB Entry: 2rsy (more details)
SCOPe Domain Sequences for d2rsya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rsya_ d.93.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gplgsmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyh asklsideevyfenlmqlvehyttdadglctrlikpkvm
Timeline for d2rsya_: