Lineage for d2rjma3 (2rjm A:187-280)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761422Domain d2rjma3: 2rjm A:187-280 [243716]
    automated match to d1fhga_

Details for d2rjma3

PDB Entry: 2rjm (more details), 2 Å

PDB Description: 3Ig structure of titin domains I67-I69 E-to-A mutated variant
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2rjma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjma3 b.1.1.0 (A:187-280) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eppvfrkkphpvetlkgadvhlecelqgtppfqvswhkdkrelrsgkkykimsenfltsi
hilnvdsadigeyqckasndvgsytcvgsitlka

SCOPe Domain Coordinates for d2rjma3:

Click to download the PDB-style file with coordinates for d2rjma3.
(The format of our PDB-style files is described here.)

Timeline for d2rjma3: