Lineage for d2r55b1 (2r55 B:6-213)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215340Species Human (Homo sapiens) [TaxId:9606] [255576] (2 PDB entries)
  8. 2215342Domain d2r55b1: 2r55 B:6-213 [243658]
    Other proteins in same PDB: d2r55a2, d2r55b2
    automated match to d1jssa_

Details for d2r55b1

PDB Entry: 2r55 (more details), 2.5 Å

PDB Description: Human StAR-related lipid transfer protein 5
PDB Compounds: (B:) StAR-related lipid transfer protein 5

SCOPe Domain Sequences for d2r55b1:

Sequence, based on SEQRES records: (download)

>d2r55b1 d.129.3.0 (B:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtleevw
dcvkpavgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvlvkry
edgtissnathvehplcppkpgfvrgfnhpcgcfceplpgeptktnlvtffhtdlsgylp
qnvvdsffprsmtrfyanlqkavkqfhe

Sequence, based on observed residues (ATOM records): (download)

>d2r55b1 d.129.3.0 (B:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtleevw
dcvkpgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvlvkryed
gtissnathvehplcppkpgfvrgfnhpcgcfceplpptktnlvtffhtdlsgylpqnvv
dsffprsmtrfyanlqkavkqfhe

SCOPe Domain Coordinates for d2r55b1:

Click to download the PDB-style file with coordinates for d2r55b1.
(The format of our PDB-style files is described here.)

Timeline for d2r55b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r55b2