Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255576] (2 PDB entries) |
Domain d2r55b_: 2r55 B: [243658] automated match to d1jssa_ |
PDB Entry: 2r55 (more details), 2.5 Å
SCOPe Domain Sequences for d2r55b_:
Sequence, based on SEQRES records: (download)
>d2r55b_ d.129.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fqsmaaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtl eevwdcvkpavgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvl vkryedgtissnathvehplcppkpgfvrgfnhpcgcfceplpgeptktnlvtffhtdls gylpqnvvdsffprsmtrfyanlqkavkqfhe
>d2r55b_ d.129.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fqsmaaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtl eevwdcvkpgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvlvk ryedgtissnathvehplcppkpgfvrgfnhpcgcfceplpptktnlvtffhtdlsgylp qnvvdsffprsmtrfyanlqkavkqfhe
Timeline for d2r55b_: