Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (21 species) not a true protein |
Species Lentinus tigrinus [TaxId:5365] [255573] (1 PDB entry) |
Domain d2qt6b1: 2qt6 B:1-131 [243641] automated match to d1a65a1 complexed with ca, cbs, cl, cu, gol, man, nag, per, tla |
PDB Entry: 2qt6 (more details), 1.5 Å
SCOPe Domain Sequences for d2qt6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qt6b1 b.6.1.0 (B:1-131) automated matches {Lentinus tigrinus [TaxId: 5365]} avgpvadltvtnanivpdgferaaivvnnvfpaplitgnmgdnfqlnlvnqmtnhtmlkt tsihwhgffqkgtnwadgpafinqcpiasgnsflydfqvpgqagtfwyhshlstqycdgl rgpfvvydpnd
Timeline for d2qt6b1: