Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (46 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196600] (6 PDB entries) |
Domain d2qsub_: 2qsu B: [243637] automated match to d2h8ga_ |
PDB Entry: 2qsu (more details), 2 Å
SCOPe Domain Sequences for d2qsub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qsub_ c.56.2.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgrda algidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdrri pipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdmeg aavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfingrn lsdl
Timeline for d2qsub_: