SCOPe 2.06: Domain d2qqja1: 2qqj A:276-433

Lineage for d2qqja1 (2qqj A:276-433)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (20 PDB entries)

8. Domain d2qqja1: 2qqj A:276-433 [243630]
   automated match to d1sddb4
   complexed with gol

Details for d2qqja1

PDB Entry: 2qqj, 1.95 Å

PDB Description: crystal structure of the b1b2 domains from human neuropilin-2

PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d2qqja1:

Sequence; same for both SEQRES and ATOM records:

>d2qqja1 b.18.1.0 (A:276-433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrf
ltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvl
nklhaplltrfvrirpqtwhsgialrlelfgcrvtdap

Timeline for d2qqja1:

• d2qqja1 first appeared in SCOPe 2.04
  
• d2qqja1 appears in SCOPe 2.05
  
• d2qqja1 appears in SCOPe 2.07
  
• d2qqja1 appears in the current release, SCOPe 2.08