Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
Domain d2qqja1: 2qqj A:276-433 [243630] automated match to d1sddb4 complexed with gol |
PDB Entry: 2qqj (more details), 1.95 Å
SCOPe Domain Sequences for d2qqja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqja1 b.18.1.0 (A:276-433) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrf ltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvl nklhaplltrfvrirpqtwhsgialrlelfgcrvtdap
Timeline for d2qqja1: