Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255566] (1 PDB entry) |
Domain d2qk4b2: 2qk4 B:106-329 [243587] Other proteins in same PDB: d2qk4a1, d2qk4a3, d2qk4b1, d2qk4b3 automated match to d1gsoa3 complexed with atp, cl, gol, so4 |
PDB Entry: 2qk4 (more details), 2.45 Å
SCOPe Domain Sequences for d2qk4b2:
Sequence, based on SEQRES records: (download)
>d2qk4b2 d.142.1.0 (B:106-329) automated matches {Human (Homo sapiens) [TaxId: 9606]} skrfakefmdrhgiptaqwkaftkpeeacsfilsadfpalvvkasglaagkgvivakske eackavqeimqekafgaagetivieelldgeevsclcftdgktvapmppaqdhkrllegd ggpntggmgaycpapqvsndlllkikdtvlqrtvdgmqqegtpytgilyagimltkngpk vlefncrfgdpecqvilpllksdlyeviqstldgllctslpvwl
>d2qk4b2 d.142.1.0 (B:106-329) automated matches {Human (Homo sapiens) [TaxId: 9606]} skrfakefmdrhgiptaqwkaftkpeeacsfilsadfpalvvkasglagvivakskeeac kavqeimqekagetivieelldgeevsclcftdgktvapmppaqdhkrllegdggpntgg mgaycpapqvsndlllkikdtvlqrtvdgmqqegtpytgilyagimltkngpkvlefncr fgdpecqvilpllksdlyeviqstldgllctslpvwl
Timeline for d2qk4b2: