Lineage for d2qk4b2 (2qk4 B:106-329)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671442Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1671443Protein automated matches [226904] (25 species)
    not a true protein
  7. 1671491Species Human (Homo sapiens) [TaxId:9606] [255566] (1 PDB entry)
  8. 1671493Domain d2qk4b2: 2qk4 B:106-329 [243587]
    Other proteins in same PDB: d2qk4a1, d2qk4a3, d2qk4b1, d2qk4b3
    automated match to d1gsoa3
    complexed with atp, cl, gol, so4

Details for d2qk4b2

PDB Entry: 2qk4 (more details), 2.45 Å

PDB Description: Human glycinamide ribonucleotide synthetase
PDB Compounds: (B:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d2qk4b2:

Sequence, based on SEQRES records: (download)

>d2qk4b2 d.142.1.0 (B:106-329) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skrfakefmdrhgiptaqwkaftkpeeacsfilsadfpalvvkasglaagkgvivakske
eackavqeimqekafgaagetivieelldgeevsclcftdgktvapmppaqdhkrllegd
ggpntggmgaycpapqvsndlllkikdtvlqrtvdgmqqegtpytgilyagimltkngpk
vlefncrfgdpecqvilpllksdlyeviqstldgllctslpvwl

Sequence, based on observed residues (ATOM records): (download)

>d2qk4b2 d.142.1.0 (B:106-329) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skrfakefmdrhgiptaqwkaftkpeeacsfilsadfpalvvkasglagvivakskeeac
kavqeimqekagetivieelldgeevsclcftdgktvapmppaqdhkrllegdggpntgg
mgaycpapqvsndlllkikdtvlqrtvdgmqqegtpytgilyagimltkngpkvlefncr
fgdpecqvilpllksdlyeviqstldgllctslpvwl

SCOPe Domain Coordinates for d2qk4b2:

Click to download the PDB-style file with coordinates for d2qk4b2.
(The format of our PDB-style files is described here.)

Timeline for d2qk4b2: