Lineage for d2qe7g_ (2qe7 G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2881030Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2881075Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 2881076Protein automated matches [190687] (7 species)
    not a true protein
  7. 2881079Species Bacillus sp. [TaxId:90973] [255563] (1 PDB entry)
  8. 2881080Domain d2qe7g_: 2qe7 G: [243554]
    Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7a3, d2qe7b1, d2qe7b2, d2qe7b3, d2qe7c1, d2qe7c2, d2qe7c3, d2qe7d1, d2qe7d2, d2qe7d3, d2qe7e1, d2qe7e2, d2qe7e3, d2qe7f1, d2qe7f2, d2qe7f3
    automated match to d2v7qg_

Details for d2qe7g_

PDB Entry: 2qe7 (more details), 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
PDB Compounds: (G:) ATP synthase subunit gamma

SCOPe Domain Sequences for d2qe7g_:

Sequence, based on SEQRES records: (download)

>d2qe7g_ c.49.2.0 (G:) automated matches {Bacillus sp. [TaxId: 90973]}
gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtkd
fshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkg
rdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqr
pvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgarm
tamgnatdnatemletltlqfnra

Sequence, based on observed residues (ATOM records): (download)

>d2qe7g_ c.49.2.0 (G:) automated matches {Bacillus sp. [TaxId: 90973]}
gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkishpmlearpvkkt
gymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkgrdffkkrgypvvee
vtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqrpvekqllpltsllp
kyaetliysalldakasefgarmtamgnatdnatemletltlqfnra

SCOPe Domain Coordinates for d2qe7g_:

Click to download the PDB-style file with coordinates for d2qe7g_.
(The format of our PDB-style files is described here.)

Timeline for d2qe7g_: