Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (11 species) not a true protein |
Species Bacillus sp. [TaxId:90973] [255559] (1 PDB entry) |
Domain d2qe7c1: 2qe7 C:27-94 [243542] Other proteins in same PDB: d2qe7a2, d2qe7a3, d2qe7b2, d2qe7b3, d2qe7c2, d2qe7c3, d2qe7d2, d2qe7d3, d2qe7e2, d2qe7e3, d2qe7f2, d2qe7f3, d2qe7g_ automated match to d1maba2 |
PDB Entry: 2qe7 (more details), 3.06 Å
SCOPe Domain Sequences for d2qe7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qe7c1 b.49.1.0 (C:27-94) automated matches {Bacillus sp. [TaxId: 90973]} evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt qvkrtgri
Timeline for d2qe7c1: