Lineage for d2q8fa2 (2q8f A:215-423)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974077Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries)
  8. 2974083Domain d2q8fa2: 2q8f A:215-423 [243525]
    Other proteins in same PDB: d2q8fa1
    automated match to d2bu8a2
    complexed with k

Details for d2q8fa2

PDB Entry: 2q8f (more details), 2.03 Å

PDB Description: Structure of pyruvate dehydrogenase kinase isoform 1
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1

SCOPe Domain Sequences for d2q8fa2:

Sequence, based on SEQRES records: (download)

>d2q8fa2 d.122.1.0 (A:215-423) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higsinpncnvlevikdgyenarrlcdlyyinspeleleelnakspgqpiqvvyvpshly
hmvfelfknamratmehhanrgvyppiqvhvtlgnedltvkmsdrgggvplrkidrlfny
mystaprprvetsravplagfgyglpisrlyaqyfqgdlklyslegygtdaviyikalst
dsierlpvynkaawkhyntnheaddwcvp

Sequence, based on observed residues (ATOM records): (download)

>d2q8fa2 d.122.1.0 (A:215-423) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higsinpncnvlevikdgyenarrlcdlyyinspeleleelnakspgqpiqvvyvpshly
hmvfelfknamratmehhanrgvyppiqvhvtlgnedltvkmsdrgggvplrkidrlfny
mystaprprvetsravplagfgyglpisrlyaqyfqgdlklyslegygtdaviyikalst
dsierlpvynkaawkhyntnaddwcvp

SCOPe Domain Coordinates for d2q8fa2:

Click to download the PDB-style file with coordinates for d2q8fa2.
(The format of our PDB-style files is described here.)

Timeline for d2q8fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q8fa1