Lineage for d2q17e_ (2q17 E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941589Species Streptomyces coelicolor [TaxId:100226] [255552] (1 PDB entry)
  8. 1941594Domain d2q17e_: 2q17 E: [243517]
    automated match to d1y1hx_
    complexed with ca

Details for d2q17e_

PDB Entry: 2q17 (more details), 2.1 Å

PDB Description: Formylglycine Generating Enzyme from Streptomyces coelicolor
PDB Compounds: (E:) formylglycine generating enzyme

SCOPe Domain Sequences for d2q17e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q17e_ d.169.1.0 (E:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
rprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvka
tghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpn
hpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqg
rfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpg
tgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandadl

SCOPe Domain Coordinates for d2q17e_:

Click to download the PDB-style file with coordinates for d2q17e_.
(The format of our PDB-style files is described here.)

Timeline for d2q17e_: