Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [255548] (1 PDB entry) |
Domain d2pqqa1: 2pqq A:1-145 [243493] Other proteins in same PDB: d2pqqa2, d2pqqa3, d2pqqb2, d2pqqc2, d2pqqd2 automated match to d3i54a1 complexed with fmt |
PDB Entry: 2pqq (more details), 2 Å
SCOPe Domain Sequences for d2pqqa1:
Sequence, based on SEQRES records: (download)
>d2pqqa1 b.82.3.0 (A:1-145) automated matches {Streptomyces coelicolor [TaxId: 100226]} mddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrt spdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpeva tallravarrlrktndamsdlvfsd
>d2pqqa1 b.82.3.0 (A:1-145) automated matches {Streptomyces coelicolor [TaxId: 100226]} mddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrt spdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpeva tallravarrlrktndamlvfsd
Timeline for d2pqqa1: