Lineage for d2pqqa1 (2pqq A:1-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2817005Species Streptomyces coelicolor [TaxId:100226] [255548] (1 PDB entry)
  8. 2817006Domain d2pqqa1: 2pqq A:1-145 [243493]
    Other proteins in same PDB: d2pqqa2, d2pqqa3, d2pqqb2, d2pqqc2, d2pqqd2
    automated match to d3i54a1
    complexed with fmt

Details for d2pqqa1

PDB Entry: 2pqq (more details), 2 Å

PDB Description: structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2)
PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2pqqa1:

Sequence, based on SEQRES records: (download)

>d2pqqa1 b.82.3.0 (A:1-145) automated matches {Streptomyces coelicolor [TaxId: 100226]}
mddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrt
spdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpeva
tallravarrlrktndamsdlvfsd

Sequence, based on observed residues (ATOM records): (download)

>d2pqqa1 b.82.3.0 (A:1-145) automated matches {Streptomyces coelicolor [TaxId: 100226]}
mddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrt
spdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpeva
tallravarrlrktndamlvfsd

SCOPe Domain Coordinates for d2pqqa1:

Click to download the PDB-style file with coordinates for d2pqqa1.
(The format of our PDB-style files is described here.)

Timeline for d2pqqa1: