SCOPe 2.08: Domain d2ph9e1: 2ph9 E:1-208

Lineage for d2ph9e1 (2ph9 E:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d2ph9e1: 2ph9 E:1-208 [243487]
   Other proteins in same PDB: d2ph9a2, d2ph9b2, d2ph9c2, d2ph9d2, d2ph9e2
   automated match to d2c9ta_
   complexed with gnt, pg4

Details for d2ph9e1

PDB Entry: 2ph9, 2.88 Å

PDB Description: galanthamine bound to an ach-binding protein

PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2ph9e1:

Sequence, based on SEQRES records:

>d2ph9e1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d2ph9e1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

Timeline for d2ph9e1:

• d2ph9e1 first appeared in SCOPe 2.04, called d2ph9e_
  
• d2ph9e1 appears in SCOPe 2.07