SCOPe 2.06: Domain d2pc5a_: 2pc5 A:

Lineage for d2pc5a_ (2pc5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255543] (3 PDB entries)

8. Domain d2pc5a_: 2pc5 A: [243469]
   automated match to d3so2a_
   complexed with mg

Details for d2pc5a_

PDB Entry: 2pc5, 2.2 Å

PDB Description: Native crystal structure analysis on Arabidopsis dUTPase

PDB Compounds: (A:) DUTP pyrophosphatase-like protein

SCOPe Domain Sequences for d2pc5a_:

Sequence; same for both SEQRES and ATOM records:

>d2pc5a_ b.85.4.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari
aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv
vevddld

Timeline for d2pc5a_:

• d2pc5a_ first appeared in SCOPe 2.04
  
• d2pc5a_ appears in SCOPe 2.05
  
• d2pc5a_ appears in SCOPe 2.07
  
• d2pc5a_ appears in the current release, SCOPe 2.08