Lineage for d2p6tg1 (2p6t G:1-65)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480158Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries)
  8. 1480181Domain d2p6tg1: 2p6t G:1-65 [243444]
    Other proteins in same PDB: d2p6ta2, d2p6tb2, d2p6tc2, d2p6td2, d2p6te2, d2p6tf2, d2p6tg2, d2p6th2
    automated match to d2p5vg1
    complexed with ca, gol, leu

Details for d2p6tg1

PDB Entry: 2p6t (more details), 2.9 Å

PDB Description: crystal structure of transcriptional regulator nmb0573 and l-leucine complex from neisseria meningitidis
PDB Compounds: (G:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p6tg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6tg1 a.4.5.0 (G:1-65) automated matches {Neisseria meningitidis [TaxId: 122586]}
mpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaalls
pesvn

SCOPe Domain Coordinates for d2p6tg1:

Click to download the PDB-style file with coordinates for d2p6tg1.
(The format of our PDB-style files is described here.)

Timeline for d2p6tg1: