Lineage for d2p6tf2 (2p6t F:66-158)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650675Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1651040Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1651041Protein automated matches [190081] (19 species)
    not a true protein
  7. 1651106Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries)
  8. 1651127Domain d2p6tf2: 2p6t F:66-158 [243443]
    Other proteins in same PDB: d2p6ta1, d2p6tb1, d2p6tc1, d2p6td1, d2p6te1, d2p6tf1, d2p6tg1, d2p6th1
    automated match to d2p5vb2
    complexed with ca, gol, leu

Details for d2p6tf2

PDB Entry: 2p6t (more details), 2.9 Å

PDB Description: crystal structure of transcriptional regulator nmb0573 and l-leucine complex from neisseria meningitidis
PDB Compounds: (F:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p6tf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6tf2 d.58.4.0 (F:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll

SCOPe Domain Coordinates for d2p6tf2:

Click to download the PDB-style file with coordinates for d2p6tf2.
(The format of our PDB-style files is described here.)

Timeline for d2p6tf2: