Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (19 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries) |
Domain d2p6tc2: 2p6t C:66-158 [243437] Other proteins in same PDB: d2p6ta1, d2p6tb1, d2p6tc1, d2p6td1, d2p6te1, d2p6tf1, d2p6tg1, d2p6th1 automated match to d2p5vb2 complexed with ca, gol, leu |
PDB Entry: 2p6t (more details), 2.9 Å
SCOPe Domain Sequences for d2p6tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6tc2 d.58.4.0 (C:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]} lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl dtllshhgvqdaqssfvlkeikhttslplnhll
Timeline for d2p6tc2: