Lineage for d2p6sc2 (2p6s C:66-158)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907294Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries)
  8. 1907304Domain d2p6sc2: 2p6s C:66-158 [243421]
    Other proteins in same PDB: d2p6sa1, d2p6sb1, d2p6sc1, d2p6sd1, d2p6se1, d2p6sf1, d2p6sg1, d2p6sh1
    automated match to d2p5vb2
    complexed with ca, gol, met

Details for d2p6sc2

PDB Entry: 2p6s (more details), 2.8 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573/L-Met Complex from Neisseria Meningitidis
PDB Compounds: (C:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p6sc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6sc2 d.58.4.0 (C:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll

SCOPe Domain Coordinates for d2p6sc2:

Click to download the PDB-style file with coordinates for d2p6sc2.
(The format of our PDB-style files is described here.)

Timeline for d2p6sc2: