SCOPe 2.08: Domain d2p6sb1: 2p6s B:3-65

Lineage for d2p6sb1 (2p6s B:3-65)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries)

8. Domain d2p6sb1: 2p6s B:3-65 [243418]
   Other proteins in same PDB: d2p6sa2, d2p6sb2, d2p6sc2, d2p6sd2, d2p6se2, d2p6sf2, d2p6sg2, d2p6sh2
   automated match to d2p5vb1
   complexed with ca, gol, met

Details for d2p6sb1

PDB Entry: 2p6s, 2.8 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573/L-Met Complex from Neisseria Meningitidis

PDB Compounds: (B:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p6sb1:

Sequence; same for both SEQRES and ATOM records:

>d2p6sb1 a.4.5.0 (B:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]}
qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
svn

Timeline for d2p6sb1:

• d2p6sb1 first appeared in SCOPe 2.04
  
• d2p6sb1 appears in SCOPe 2.07