Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (59 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries) |
Domain d2ovlb2: 2ovl B:130-362 [243395] Other proteins in same PDB: d2ovla1, d2ovlb1, d2ovlc1, d2ovld1 automated match to d3bjsa2 complexed with na |
PDB Entry: 2ovl (more details), 2.13 Å
SCOPe Domain Sequences for d2ovlb2:
Sequence, based on SEQRES records: (download)
>d2ovlb2 c.1.11.0 (B:130-362) automated matches {Streptomyces coelicolor [TaxId: 100226]} ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal asvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrlav
>d2ovlb2 c.1.11.0 (B:130-362) automated matches {Streptomyces coelicolor [TaxId: 100226]} ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal asvphrtymeahlhaymaepmavtdgcvsapdrpghgvvldferlgrlav
Timeline for d2ovlb2: