SCOPe 2.05: Domain d2ovlb1: 2ovl B:3-129

Lineage for d2ovlb1 (2ovl B:3-129)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)

8. Domain d2ovlb1: 2ovl B:3-129 [243394]
   Other proteins in same PDB: d2ovla2, d2ovlb2, d2ovlc2, d2ovld2
   automated match to d3bjsa1
   complexed with na

Details for d2ovlb1

PDB Entry: 2ovl, 2.13 Å

PDB Description: crystal structure of a racemase from streptomyces coelicolor a3(2)

PDB Compounds: (B:) Putative racemase

SCOPe Domain Sequences for d2ovlb1:

Sequence; same for both SEQRES and ATOM records:

>d2ovlb1 d.54.1.0 (B:3-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
lwklfgg

Timeline for d2ovlb1:

• d2ovlb1 first appeared in SCOPe 2.04
  
• d2ovlb1 appears in SCOPe 2.06
  
• d2ovlb1 appears in the current release, SCOPe 2.08