SCOPe 2.04: Domain d2otkf_: 2otk F:

Lineage for d2otkf_ (2otk F:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein automated matches [191290] (4 species)
   not a true protein

7. Species Engineered binding [255533] (1 PDB entry)

8. Domain d2otkf_: 2otk F: [243379]
   automated match to d1ss1a_

Details for d2otkf_

PDB Entry: 2otk

PDB Description: structure of alzheimer ab peptide in complex with an engineered binding protein

PDB Compounds: (F:) ZAb3 Affibody dimer

SCOPe Domain Sequences for d2otkf_:

Sequence; same for both SEQRES and ATOM records:

>d2otkf_ a.8.1.1 (F:) automated matches {Engineered binding}
geivylpnlnpdqlcafihslhddpsqsanllaeakklndaqa

Timeline for d2otkf_:

• d2otkf_ is new in SCOPe 2.04-stable
  
• d2otkf_ appears in SCOPe 2.05
  
• d2otkf_ appears in the current release, SCOPe 2.08