Lineage for d2oqyf2 (2oqy F:123-374)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574084Species Oceanobacillus iheyensis [TaxId:182710] [255531] (1 PDB entry)
  8. 1574090Domain d2oqyf2: 2oqy F:123-374 [243369]
    Other proteins in same PDB: d2oqya1, d2oqyb1, d2oqyc1, d2oqyd1, d2oqye1, d2oqyf1, d2oqyg1, d2oqyh1
    automated match to d3sjna2
    complexed with mg

Details for d2oqyf2

PDB Entry: 2oqy (more details), 2 Å

PDB Description: the crystal structure of muconate cycloisomerase from oceanobacillus iheyensis
PDB Compounds: (F:) Muconate cycloisomerase

SCOPe Domain Sequences for d2oqyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqyf2 c.1.11.0 (F:123-374) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlsw

SCOPe Domain Coordinates for d2oqyf2:

Click to download the PDB-style file with coordinates for d2oqyf2.
(The format of our PDB-style files is described here.)

Timeline for d2oqyf2: