Lineage for d1ynaa_ (1yna A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780204Species Thermomyces lanuginosus [TaxId:5541] [49986] (1 PDB entry)
  8. 2780205Domain d1ynaa_: 1yna A: [24335]

Details for d1ynaa_

PDB Entry: 1yna (more details), 1.55 Å

PDB Description: endo-1,4-beta-xylanase, room temperature, ph 4.0
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1ynaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynaa_ b.29.1.11 (A:) Xylanase II {Thermomyces lanuginosus [TaxId: 5541]}
ettpnsegwhdgyyyswwsdggaqatytnleggtyeiswgdggnlvggkgwnpglnarai
hfegvyqpngnsylavygwtrnplveyyivenfgtydpssgatdlgtvecdgsiyrlgkt
trvnapsidgtqtfdqywsvrqdkrtsgtvqtgchfdawaraglnvngdhyyqivategy
fssgyaritvadvg

SCOPe Domain Coordinates for d1ynaa_:

Click to download the PDB-style file with coordinates for d1ynaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ynaa_: