Lineage for d2oepa2 (2oep A:271-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904179Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 1904180Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 1904210Family d.48.1.0: automated matches [227236] (1 protein)
    not a true family
  6. 1904211Protein automated matches [226990] (3 species)
    not a true protein
  7. 1904212Species Mycobacterium smegmatis [TaxId:1772] [255525] (3 PDB entries)
  8. 1904214Domain d2oepa2: 2oep A:271-330 [243323]
    Other proteins in same PDB: d2oepa1
    automated match to d2zrma2
    protein/DNA complex; complexed with adp

Details for d2oepa2

PDB Entry: 2oep (more details), 3.1 Å

PDB Description: MSrecA-ADP-complex
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2oepa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oepa2 d.48.1.0 (A:271-330) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg

SCOPe Domain Coordinates for d2oepa2:

Click to download the PDB-style file with coordinates for d2oepa2.
(The format of our PDB-style files is described here.)

Timeline for d2oepa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oepa1