SCOPe 2.04: Domain d2odna2: 2odn A:271-330

Lineage for d2odna2 (2odn A:271-330)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
   alpha-beta(3)-alpha(2); 2 layers, alpha/beta

4. Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families)

5. Family d.48.1.0: automated matches [227236] (1 protein)
   not a true family

6. Protein automated matches [226990] (2 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [255525] (3 PDB entries)

8. Domain d2odna2: 2odn A:271-330 [243317]
   Other proteins in same PDB: d2odna1
   automated match to d2zrma2
   protein/DNA complex; complexed with dtp

Details for d2odna2

PDB Entry: 2odn, 3.1 Å

PDB Description: msreca-datp complex

PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2odna2:

Sequence; same for both SEQRES and ATOM records:

>d2odna2 d.48.1.0 (A:271-330) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg

Timeline for d2odna2:

• d2odna2 is new in SCOPe 2.04-stable
  
• d2odna2 appears in SCOPe 2.05
  
• d2odna2 appears in the current release, SCOPe 2.08