Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins) |
Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species) |
Species Lactococcus lactis [TaxId:1358] [255517] (1 PDB entry) |
Domain d2o20b_: 2o20 B: [243274] automated match to d2nzug_ complexed with cl, so4 |
PDB Entry: 2o20 (more details), 1.9 Å
SCOPe Domain Sequences for d2o20b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o20b_ c.93.1.1 (B:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} laskrtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletfls kqvdgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklid sgnkkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerlle rgatsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydl gavamrlltklmlkedveqnqlvldheifsrrstk
Timeline for d2o20b_: