Lineage for d2o20b_ (2o20 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624508Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1624554Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. 1624588Species Lactococcus lactis [TaxId:1358] [255517] (1 PDB entry)
  8. 1624590Domain d2o20b_: 2o20 B: [243274]
    automated match to d2nzug_
    complexed with cl, so4

Details for d2o20b_

PDB Entry: 2o20 (more details), 1.9 Å

PDB Description: crystal structure of transcription regulator ccpa of lactococcus lactis
PDB Compounds: (B:) Catabolite control protein A

SCOPe Domain Sequences for d2o20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o20b_ c.93.1.1 (B:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
laskrtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletfls
kqvdgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklid
sgnkkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerlle
rgatsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydl
gavamrlltklmlkedveqnqlvldheifsrrstk

SCOPe Domain Coordinates for d2o20b_:

Click to download the PDB-style file with coordinates for d2o20b_.
(The format of our PDB-style files is described here.)

Timeline for d2o20b_: