SCOPe 2.04: Domain d2o1kb_: 2o1k B:

Lineage for d2o1kb_ (2o1k B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families)
   not a true superfamily

5. Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)

6. Protein automated matches [254616] (4 species)
   not a true protein

7. Species Rotavirus a [TaxId:10923] [255515] (1 PDB entry)

8. Domain d2o1kb_: 2o1k B: [243270]
   automated match to d1g1ja_
   complexed with ca

Details for d2o1kb_

PDB Entry: 2o1k, 1.67 Å

PDB Description: structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4

PDB Compounds: (B:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d2o1kb_:

Sequence; same for both SEQRES and ATOM records:

>d2o1kb_ h.1.13.1 (B:) automated matches {Rotavirus a [TaxId: 10923]}
iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq

Timeline for d2o1kb_:

• d2o1kb_ is new in SCOPe 2.04-stable
  
• d2o1kb_ appears in SCOPe 2.05
  
• d2o1kb_ appears in the current release, SCOPe 2.08