SCOPe 2.07: Domain d2npra1: 2npr A:1-46

Lineage for d2npra1 (2npr A:1-46)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)

6. Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)

7. Species Plasmodium vivax [TaxId:31273] [255510] (1 PDB entry)

8. Domain d2npra1: 2npr A:1-46 [243223]
   automated match to d1b9wa1

Details for d2npra1

PDB Entry: 2npr

PDB Description: structural studies on plasmodium vivax merozoite surface protein-1

PDB Compounds: (A:) Merozoite surface protein 1

SCOPe Domain Sequences for d2npra1:

Sequence; same for both SEQRES and ATOM records:

>d2npra1 g.3.11.4 (A:1-46) Merozoite surface protein 1 (MSP-1) {Plasmodium vivax [TaxId: 31273]}
tmssehtcidtnvpdnaacyryldgteewrclltfkeeggkcvpas

Timeline for d2npra1:

• d2npra1 first appeared in SCOPe 2.04
  
• d2npra1 appears in SCOPe 2.06
  
• d2npra1 appears in the current release, SCOPe 2.08