SCOPe 2.08: Domain d2np2b_: 2np2 B:

Lineage for d2np2b_ (2np2 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (11 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255508] (1 PDB entry)

8. Domain d2np2b_: 2np2 B: [243216]
   automated match to d1p71a_
   protein/DNA complex

Details for d2np2b_

PDB Entry: 2np2, 3.02 Å

PDB Description: Hbb-DNA complex

PDB Compounds: (B:) Hbb

SCOPe Domain Sequences for d2np2b_:

Sequence; same for both SEQRES and ATOM records:

>d2np2b_ a.55.1.0 (B:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
rpkvtksdivdqialniknnnlklekkyirlvidaffeelksnlcsnnviefrsfgtfev
rkrkgrlnarnpqtgeyvkvldhhvayfrpgkdlkervwgik

Timeline for d2np2b_:

• d2np2b_ first appeared in SCOPe 2.04
  
• d2np2b_ appears in SCOPe 2.07