SCOPe 2.05: Domain d2mk2a_: 2mk2 A:

Lineage for d2mk2a_ (2mk2 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (41 PDB entries)

8. Domain d2mk2a_: 2mk2 A: [243192]
   automated match to d1i3za_

Details for d2mk2a_

PDB Entry: 2mk2

PDB Description: Solution NMR structure of N-terminal domain (SH2 domain) of human Inositol polyphosphate phosphatase-like protein 1 (INPPL1) (fragment 20-117), Northeast Structural Genomics Consortium Target HR9134A

PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2

SCOPe Domain Sequences for d2mk2a_:

Sequence; same for both SEQRES and ATOM records:

>d2mk2a_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshmswyhrdlsraaaeellaragrdgsflvrdsesvagafalcvlyqkhvht
yrilpdgedflavqtsqgvpvrrfqtlgeliglyaqpnqglvcalllpv

Timeline for d2mk2a_:

• d2mk2a_ first appeared in SCOPe 2.04
  
• d2mk2a_ is called d2mk2a1 in SCOPe 2.06
  
• d2mk2a_ appears in the current release, SCOPe 2.08, called d2mk2a1