Lineage for d2mk2a_ (2mk2 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662299Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)
  8. 1662349Domain d2mk2a_: 2mk2 A: [243192]
    automated match to d1i3za_

Details for d2mk2a_

PDB Entry: 2mk2 (more details)

PDB Description: Solution NMR structure of N-terminal domain (SH2 domain) of human Inositol polyphosphate phosphatase-like protein 1 (INPPL1) (fragment 20-117), Northeast Structural Genomics Consortium Target HR9134A
PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2

SCOPe Domain Sequences for d2mk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mk2a_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshmswyhrdlsraaaeellaragrdgsflvrdsesvagafalcvlyqkhvht
yrilpdgedflavqtsqgvpvrrfqtlgeliglyaqpnqglvcalllpv

SCOPe Domain Coordinates for d2mk2a_:

Click to download the PDB-style file with coordinates for d2mk2a_.
(The format of our PDB-style files is described here.)

Timeline for d2mk2a_: