Lineage for d2mgra1 (2mgr A:1-48)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636528Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 2636529Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)
  7. 2636554Species Plasmodium yoelii [TaxId:73239] [255502] (2 PDB entries)
  8. 2636555Domain d2mgra1: 2mgr A:1-48 [243183]
    automated match to d1ob1c1
    mutant

Details for d2mgra1

PDB Entry: 2mgr (more details)

PDB Description: Structure of Plasmodium Yoelii Merozoite Surface Protein 1 - C-terminal Domain, E28K mutant
PDB Compounds: (A:) Merozoite surface protein 1

SCOPe Domain Sequences for d2mgra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgra1 g.3.11.4 (A:1-48) Merozoite surface protein 1 (MSP-1) {Plasmodium yoelii [TaxId: 73239]}
gvdpkhvcvdtrdipknagcfrdddgtkewrcllgykkgegntcvenn

SCOPe Domain Coordinates for d2mgra1:

Click to download the PDB-style file with coordinates for d2mgra1.
(The format of our PDB-style files is described here.)

Timeline for d2mgra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mgra2