Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
Species Plasmodium yoelii [TaxId:73239] [255502] (2 PDB entries) |
Domain d2mgra1: 2mgr A:1-48 [243183] automated match to d1ob1c1 mutant |
PDB Entry: 2mgr (more details)
SCOPe Domain Sequences for d2mgra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mgra1 g.3.11.4 (A:1-48) Merozoite surface protein 1 (MSP-1) {Plasmodium yoelii [TaxId: 73239]} gvdpkhvcvdtrdipknagcfrdddgtkewrcllgykkgegntcvenn
Timeline for d2mgra1: