Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
Species Plasmodium yoelii [TaxId:73239] [255502] (2 PDB entries) |
Domain d2mgpa2: 2mgp A:49-99 [243182] automated match to d1ceja2 |
PDB Entry: 2mgp (more details)
SCOPe Domain Sequences for d2mgpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mgpa2 g.3.11.4 (A:49-99) Merozoite surface protein 1 (MSP-1) {Plasmodium yoelii [TaxId: 73239]} nptcdinnggcdptascqnaestenskkiictckeptpnayyegvfcssss
Timeline for d2mgpa2: