SCOPe 2.06: Domain d2md5a1: 2md5 A:329-426

Lineage for d2md5a1 (2md5 A:329-426)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189892] (3 PDB entries)

8. Domain d2md5a1: 2md5 A:329-426 [243175]
   Other proteins in same PDB: d2md5a2
   automated match to d4avpa_

Details for d2md5a1

PDB Entry: 2md5

PDB Description: Structure of uninhibited ETV6 ETS domain

PDB Compounds: (A:) transcription factor etv6

SCOPe Domain Sequences for d2md5a1:

Sequence; same for both SEQRES and ATOM records:

>d2md5a1 a.4.5.0 (A:329-426) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
griadsrllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmtye
kmsralrhyyklniirkepgqrllfrfmktpdeimsgr

Timeline for d2md5a1:

• d2md5a1 first appeared in SCOPe 2.04, called d2md5a_
  
• d2md5a1 was called d2md5a_ in SCOPe 2.05
  
• d2md5a1 appears in SCOPe 2.07
  
• d2md5a1 appears in the current release, SCOPe 2.08