Lineage for d2md5a_ (2md5 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480124Species Mouse (Mus musculus) [TaxId:10090] [189892] (3 PDB entries)
  8. 1480128Domain d2md5a_: 2md5 A: [243175]
    automated match to d4avpa_

Details for d2md5a_

PDB Entry: 2md5 (more details)

PDB Description: Structure of uninhibited ETV6 ETS domain
PDB Compounds: (A:) transcription factor etv6

SCOPe Domain Sequences for d2md5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2md5a_ a.4.5.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gshmgriadsrllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtn
mtyekmsralrhyyklniirkepgqrllfrfmktpdeimsgr

SCOPe Domain Coordinates for d2md5a_:

Click to download the PDB-style file with coordinates for d2md5a_.
(The format of our PDB-style files is described here.)

Timeline for d2md5a_: