SCOPe 2.05: Domain d2mcna_: 2mcn A:

Lineage for d2mcna_ (2mcn A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (23 PDB entries)

8. Domain d2mcna_: 2mcn A: [243169]
   Other proteins in same PDB: d2mcnb_
   automated match to d2j6ka_

Details for d2mcna_

PDB Entry: 2mcn

PDB Description: distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications

PDB Compounds: (A:) CD2-associated protein

SCOPe Domain Sequences for d2mcna_:

Sequence; same for both SEQRES and ATOM records:

>d2mcna_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik

Timeline for d2mcna_:

• d2mcna_ first appeared in SCOPe 2.04
  
• d2mcna_ appears in SCOPe 2.06
  
• d2mcna_ appears in the current release, SCOPe 2.08