Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [255485] (1 PDB entry) |
Domain d2m5wa_: 2m5w A: [243120] automated match to d1s29a_ |
PDB Entry: 2m5w (more details)
SCOPe Domain Sequences for d2m5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m5wa_ a.4.5.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} mseetstqilkqveyyfsdsnfprdkflrseaaknvdnyisidviasfnrmktistdlql itealkkstrlqvsedgkmvrrldplpenid
Timeline for d2m5wa_: