SCOPe 2.06: Domain d2m4na1: 2m4n A:2-108

Lineage for d2m4na1 (2m4n A:2-108)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries)

8. Domain d2m4na1: 2m4n A:2-108 [243106]
   Other proteins in same PDB: d2m4na2
   automated match to d1wxaa1

Details for d2m4na1

PDB Entry: 2m4n

PDB Description: Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans

PDB Compounds: (A:) Protein AFD-1, isoform a

SCOPe Domain Sequences for d2m4na1:

Sequence; same for both SEQRES and ATOM records:

>d2m4na1 d.15.1.0 (A:2-108) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mfggslkvyggeivptrpyvsilaeinenadrilgaalekyglehskddfilvevsnddd
rksmsdlreidgrpipptecplfemtarsgngengfdsflaikrkph

Timeline for d2m4na1:

• d2m4na1 first appeared in SCOPe 2.04, called d2m4na_
  
• d2m4na1 was called d2m4na_ in SCOPe 2.05
  
• d2m4na1 appears in SCOPe 2.07
  
• d2m4na1 appears in the current release, SCOPe 2.08