Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein automated matches [190637] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries) |
Domain d2m49a_: 2m49 A: [243102] Other proteins in same PDB: d2m49b_, d2m49d_ automated match to d1ev2a_ |
PDB Entry: 2m49 (more details)
SCOPe Domain Sequences for d2m49a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m49a_ b.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamke dgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail flpmsa
Timeline for d2m49a_: